Florian Cramer on Mon, 22 Sep 2003 06:44:02 +0200 (CEST) |
[Date Prev] [Date Next] [Thread Prev] [Thread Next] [Date Index] [Thread Index]
<nettime> unstable digest vol 65 |
Date: Fri, 19 Sep 2003 12:17:52 +0100 From: Ana Buigues <[email protected]> To: [email protected] Subject: error de [ISO-8859-1] p=E1gina no [ISO-8859-1] v=E1lida IEXPLORE provoc� un error de p�gina no v�lida en el m�dulo HTTP3260.DLL de 016f:62352039. Registros: EAX=80004002 CS=016f EIP=62352039 EFLGS=00010297 EBX=04600100 SS=0177 ESP=0058d578 EBP=0058d57c ECX=60b86a18 DS=0177 ESI=046002bf FS=3987 EDX=00000044 ES=0177 EDI=00000000 GS=0000 Bytes en CS:EIP: ,02x ,02x ,02x ,02x ,02x ,02x ,02x ,02x ,02x ,02x ,02x ,02x ,02x ,02x ,02x ,02x Volcado de pila: ,08x ,08x ,08x ,08x ,08x ,08x ,08x ,08x ,08x ,08x ,08x ,08x ,08x ,08x ,08x ,08x nothing works lately everything is wrong i keep hating computers i don't even understand what this 'error de p�gina no v�lida' is or know how to fix it do i want to fix it? i need to access that page do i have time to fix it? no do i have the knowledge to fix it? no why not? nothing makes sense i just wanted to work on my thesis, is that so much to ask? life with computers sucks Date: Tue, 16 Sep 2003 17:00:13 -0700 From: Joe Gray <[email protected]> To: [email protected] Subject: :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':., )0(-=- )0({O} )0(-=- )0({O} )0(-:':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :' ` >>>>> , '':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> } )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0({O} :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :'0({O =- )0({O} )0(-=- >>> )0({O} )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0( >> =- )0({O} )0(-=- )0({O} )0(-=- )0({O} )0(: )0({O} )0(-=- ) )0({O} >> )0(-=- )0( >>>>> , , , >>>> * * >>> ) ., * ` >>>> * * >>> * >>>> :':.,.:': :':.,.:': :':.,.:': -=- )0({O} )0(-=-:':.,.:': :':.,.:': >>>> :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :=- )0({O} )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0 : >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,. :.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': ::': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':. :.,.:': :':.,.:': :':.,.:': ({O} >>> )0(-=- )0( >>> =- )0({O} )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0(} >>> )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0({O )0(=- )0({O} >>> )0(-=- )0({O} )0(-=- )0({O ,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :'} )0(-=-:.,.:':':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>> :':.,.:': >>> )0(-=- )0({O} )0(-=- )0({O :' * ` >>> )- * '- ` >>>> )( * ' >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:'::.,.:': :' :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': =-.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': =- )0({O} )0(-=- )0({O =- )0({O .:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :'':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:':} )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0(} >>>> )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0({O} )0(-=- )0({O} )0(-:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':., >>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>> >>>>>>>>>>>>>>>>>>>>>> >>>> .:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': >>>> :':.,.:': :':., :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,. >>>>>>>>>>>>>>>>>>> >>> >>>> * ` >>> )- * '- ` >>>> )( * ' >>>> ` >>>>> , , , >>>> * * >>> ) ., * ` >>>> * * >>> * >>>>> , ' >>>>>>> >>>> ; >>>>> ` >>>>> , >>>> >>>> >>>> >>> >>> >> To: [email protected],[email protected],[email protected], From: "net.l[w]urker" <[email protected]> Subject: _g.lewd pub[l]ic_ 08:44am 18/09/2003 Date: Thu, 18 Sep 2003 08:50:13 +1000 _g.lewd pub[l]ic_ 08:44am 18/09/2003 --switch in2: welcum:not[e]ing:+:drag.fish.net[wurk]ing --via.libido.[str]angles --arc.ing.silk.+ pushing.tin[ned emotional bleeding] --sittin.drenched.in.reversable.affective.glo[SS]wing --i.w[l]ilt.thru.voicelessness. :( _____________________________________ _hair.data.Prin[t].cess_ 08:44am 05/09/2003 _conception.thru.a.scar.spoon_ _[bl]own.blossoms.in.looped.fe[e]back.gloss_ _rippingNwaning.via.blandesque.caramelle.jerks_ _layered N drossed_ _b.ox.ing.in2.terror.formers_ _kic.king[/prin(t)cessing] N flossing_ _____________________________________________ _D[C|R]a[sh]ta_ 11:03am 28/08/2003 _G|Raft singular [rose.planting + p|etal.bash.ing] [drowning.in.(the)sub.lim(e)it.y] [i.c(++)ed.up.+.crashing.the.in.fo(r)m] _Crashin_vs_the Opu.Lent [dragging_physical + lagging_m.o(f.fur.ings)tives] . - pro][rating][.lucid.txt - - http://www.hotkey.net.au/~netwurker http://www.livejournal.com/users/netwurker/ _ _cr[xxx]oss ova.ring. From: "edx" <[email protected]> To: "Lanny Quarles" <[email protected]>, Subject: Another try at "Executable Text", in VBScript Date: Sun, 14 Sep 2003 15:20:11 -0400 BEGIN Sub Main( arg a ) I'mNotThinking(a); return 1; End Sub Sub WhileI'mNotThinking(arg a) a.Present(); While Not a.Event.Argument == vbStop { so Long As ( [white ray dividing paper], [ words make no sense] ) { Align(); Align Code to Being(); Align Praxis to Output(); Align Vision to Optics(); Align Sound to Math(); ReAlign, there is a 'rabbit' free...... } Do..... { Continue. } End Do. } Present(); Repeat(); End Sub END DOES NOT COMPILE!!!! Date: Wed, 17 Sep 2003 22:32:34 -0700 From: Lanny Quarles <[email protected]> Subject: Fw: Prairie Tower To: [email protected] Prairie Tower [The Woman Who Did! by Grant Allen [Alan] 1848-99] Somnabulist Gateway of "Deelish" POSTurban/grouse/ sexuality of feathered sacs/ sexuality of feathered sacs/ tethered to fond mnemosine sexuality of feathered sacs/ tethered to explosion's engram sexuality of feathered sacs/ tethered to blue sky adjacent tragedy sexuality of feathered sacs/ tethered to human integrin [saliva of bystander] sexuality of feathered sacs/ tethered to aerial spectacle of devolving |T|H|E{|O|S} sexuality of feathered sacs/ tethered to silicon (manufactured skulls) sexuality of feathered sacs/ tethered to Prairie Towers sexuality of feathered sacs/ tethered to UN Tower under cover of vines growing corpses sexuality of feathered sacs/ tethered to Unitary display characteristics sexuality of feathered sacs/ tethered to devolving engram of exploding theology sexuality of feathered sacs/ tethered to devolving telos of exploding engram sexuality of feathered sacs/ tethered to hypoiconic noise of consciousnessprotein sexuality of feathered sacs/tethered to groin, anus, eyelids, corona, labiamajorum sexuality of feathered sacs/tethered to groan, assault, field of daisies, tombstone production rates, length of jissomarc sexuality of feathered sacs/tethered to brownskin, orangeskin, greenskin, blueskin, masturbation, comma sexuality of feathered sacs/tethered to cunnilinguis, fellatio of unnumbered statistics, coma, periplum of breasts, clothing, buttocks, noses /organism="Homo sapiens" /db_xref="taxon:9606" SecStr 2..9 /sec_str_type="sheet" /note="strand 1" SecStr 23..32 /sec_str_type="helix" /note="helix 1" SecStr 34..39 /sec_str_type="sheet" /note="strand 2" SecStr 51..58 /sec_str_type="sheet" /note="strand 3" SecStr 59..72 /sec_str_type="helix" /note="helix 2" 1: 1DT4 A 0 Chain A, Domain 0, Crystal Structure Of Nova-1 Kh3 K-Homology Rna-Binding Domain [sdi:38065] 2: 1KHM A 0 Chain A, Domain 0, C-Terminal Kh Domain Of Hnrnp K (Kh3) [sdi:36665] 3: 1DLO B 4 Chain B, Domain 1, Human Immunodeficiency Virus Type 1 [sdi:12865] 4: 1DTJ C 0 Chain C, Domain 0, Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Binding Domain [sdi:37951] 5: 1RTD D 11 Chain D, Domain 1, Structure Of A Catalytic Complex Of Hiv-1 Reverse Transcriptase: Implications For Nucleoside Analog Drug Resistance [sdi:36964] 6: 1BE4 C 0 Chain C, Domain 0, Nucleoside Diphosphate Kinase Isoform B From Bovine Retina [sdi:26662] 7: 1ELO 3 Domain 3, Elongation Factor G Without Nucleotide [sdi:12844] 8: 1NSP 0 Domain 0, Nucleoside Diphosphate Kinase (E.C.2.7.4.6) [sdi:8608] 9: 1BUX A 0 Chain A, Domain 0, 3'-Phosphorylated Nucleotides Binding To Nucleoside Diphosphate Kinase [sdi:28183] 10: 1RTD B 5 Chain B, Domain 1, Structure Of A Catalytic Complex Of Hiv-1 Reverse Transcriptase: Implications For Nucleoside Analog Drug Resistance [sdi:36956] 11: 1CJU A 0 Chain A, Domain 0, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With Beta-L-2',3'-Dideoxyatp And Mg [sdi:33707] 12: 1OTP 2 Domain 2, Structural And Theoretical Studies Suggest Domain Movement Produces An Active Conformation Of Thymidine Phosphorylase [sdi:25756] 13: 1KDN C 0 Chain C, Domain 0, Structure Of Nucleoside Diphosphate Kinase [sdi:15831] 14: 2FMR 0 Domain 0, Kh1 From The Fragile X Protein Fmr1, Nmr, 18 Structures [sdi:21787] 15: 2BEF A 0 Chain A, Domain 0, Crystal Structure Of Ndp Kinase Complexed With Mg, Adp, And Bef3 [sdi:24261] 16: 1QE1 B 5 Chain B, Domain 1, Crystal Structure Of 3tc-Resistant M184i Mutant Of Hiv-1 Reverse Transcriptase [sdi:39244] 17: 2JEL P 0 Chain P, Domain 0, Jel42 FabHPR COMPLEX [sdi:22143] 18: 1CLI A 2 Chain A, Domain 2, X-Ray Crystal Structure Of Aminoimidazole Ribonucleotide Synthetase (Purm), From The E. Coli Purine Biosynthetic Pathway, At 2.5 A Resolution [sdi:31958] 19: 1NDP A 0 Chain A, Domain 0, Nucleoside Diphosphate Kinase (E.C.2.7.4.6) Complexed With Adp [sdi:4178] 20: 1CJV A 0 Chain A, Domain 0, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With Beta-L-2',3'-Dideoxyatp, Mg, And Zn [sdi:33712] 38065 1: pfam03858 Crust_neuro_H: Crustacean neurohormone H. These proteins are referred to as precursor-related peptides as they are typically co-transcribed and translated with the CHH neurohormone (pfam01147). However, in some species this neuropeptide is synthesised as a separate protein. Furthermore, neurohormone H can undergo proteolysis to give rise to 5 different neuropeptides. [pfam03858|8785] 10 20 30 40 50 60 ....*....|....*....|....*....|....*....|....*....|....*....| consensus 1 MFSKTNLFLCLSLAILLIVISSQADAREMS-KASAPITQAMNSNNITEQKK-----VGRH 54 gi 170341 1 MFSKTNLFLCLSLAILLIVISSQADARETS-KATAPITQEMNSNNTTDQKIpkrpkPGGN 59 gi 6689818 1 MFSKTNLFLCLSLAILLIVISSQADAREMS-KAAAPITHAMNSNNITNQKT------GAG 53 gi 6601329 1 MVSKSSIFICLSL-IILVIMSTQIVAREMTsEASASLTQAMNGNNISETKK-----VGRH 54 70 80 90 100 ....*....|....*....|....*....|....*....|....*.... consensus 55 IVKKLD-------QICSKIFKAGKV-IAGKTCKICSCKTQICSKCPKCH 95 gi 170341 60 IFGKACkicpckyQICSKCPKCDDQnIAGKFCKICSCKTQICSKCPKCH 108 gi 6689818 54 IIRKIP-------GWIRKGAKPGGK-VAGKACKICSCKYQICSKCPKCH 94 gi 6601329 55 LVKGLD-----------KIFKAGKV-IYCKTCKTCHGR---CDYC--CA 86 LOCUS AAF23855 95 aa linear PLN 11-JAN-2000 DEFINITION unknown [Nicotiana tabacum]. ACCESSION AAF23855 VERSION AAF23855.1 GI:6689818 DBSOURCE locus U64815 accession U64815.1 KEYWORDS . SOURCE Nicotiana tabacum (common tobacco) ORGANISM Nicotiana tabacum Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; core eudicots; asterids; lamiids; Solanales; Solanaceae; Nicotiana. REFERENCE 1 (residues 1 to 95) AUTHORS Moraes,M.G. and Goodman,R.M. TITLE Structure and expression of tobacco Sar8.2 gene family JOURNAL Unpublished REFERENCE 2 (residues 1 to 95) AUTHORS Moraes,M.G. and Goodman,R.M. TITLE Direct Submission JOURNAL Submitted (23-JUL-1996) Plant Pathology, University of Wisconsin, 1630 Linden Drive, Madison, WI 53706, USA COMMENT Method: conceptual translation. FEATURES Location/Qualifiers source 1..95 /organism="Nicotiana tabacum" /db_xref="taxon:4097" Protein 1..95 /product="unknown" CDS 1..95 /gene="Sar8.2d" /coded_by="join(U64815.1:217..331,U64815.1:1593..1765)" ORIGIN 1 mfsktnlflc lslaillivi ssqadarems kaaapitham nsnnitnqkt gagiirkipg 61 wirkgakpgg kvagkackic sckyqicskc pkchd // FEATURES Location/Qualifiers source 1..2013 /organism="Nicotiana tabacum" /mol_type="genomic DNA" /db_xref="taxon:4097" gene 217..1765 /gene="Sar8.2d" CDS join(217..331,1593..1765) /gene="Sar8.2d" /codon_start=1 /product="unknown" /protein_id="AAF23855.1" /db_xref="GI:6689818" /translation="MFSKTNLFLCLSLAILLIVISSQADAREMSKAAAPITHAMNSNN ITNQKTGAGIIRKIPGWIRKGAKPGGKVAGKACKICSCKYQICSKCPKCHD" BASE COUNT 658 a 330 c 344 g 681 t ORIGIN 1 ctcaatggaa accactcacc caacaaatca atcaaccttg gctggcgtga cttcacagta 61 ggtctttgtg aagtgtttct ttttgtcatt attcttcctt gtttagaaca agttgttctg 121 agagttgcac gagacattat taagttctat aaatagggga gaaacattgt tttccttttt 181 acagtaaaaa actgaaactc caaatagctc atcaaaatgt tttccaaaac taaccttttt 241 ctttgccttt ctttggctat tttgctaatt gtaatatcct cacaagctga tgcaagggag 301 atgtctaagg cggctgctcc aattacccat ggtttattta cttcttcaat ctattactac 361 tccagtagtt attttcattt ttgacatttt gagtctgcaa acgaatgcta taaatgttta 421 aatattcatg taacatattt ctttgaattt tatgatctta aatatgtcat aatatcttat 481 acagaagtct tattaatgaa aaaaatcgga atttcggaat taaaaagtta ttaaatgttg 541 gtggcattct ttgttgaaac ggatttaaaa ggaaagtaaa acacatgata gaaacgaagg 601 gagttatatg tttgcataag ttattattta acattttact gaaagtttaa tggacatttt 661 gaaactttct gagacattct acatctaaaa tatttagtaa cttaggatat cacaacaccg 721 cagaagtttc ttctttttat ccttattgaa tttggtgatt acctcgttta aattctattg 781 ctagagtaag gacttcaatt aattattttt atgtctgcaa catgcattct tacatgcggc 841 catgattctt tcttcttggc caaacaacgt gaaaatatct ttacttttgg atggcgttaa 901 gatttgaata tttcgaaacc ttgttttggc caattgtgtg atcaataaca ataacaacaa 961 acttagaata atttcacaag tggggttatc gaaagaataa tgtttatgca aatcttaccc 1021 ttgtcttgag aagctagata gactgtttcc gataaaccct cgactcaaga aaggatgaaa 1081 aggcagtaga aattaaataa gcagtaatac cagcaagata ataaaataat cgaagcaaaa 1141 gaatcagtat gtagtgagaa aaatctgaaa ataagaaaat acaagactaa cacttatatt 1201 actagtaagg acaagggaga tgcacggcta cctactaacc ttctatccta attctcgact 1261 ttcacgccct cctatcaagg gtcatgtcct tactatttag ggatagaggt taggggacaa 1321 gacaatgcag gatactacta actttttatc taattctcgg gtcaaagtct tctaacaagg 1381 gtcatgtctt cggtaagctg aagcaaacgc aatatcctgt caattgtgtg atcattttat 1441 ttaaaactta agctattaga ggaggaacct aaattcatcc taatttattt atgtatgcag 1501 cactgagaat taatatggtt acaaattaat ttactccttt attggttaac ctataactaa 1561 tacattactc tacataacct aatttgatgc agcaatgaat tcaaacaaca ttactaatca 1621 gaagacgggt gccggaatca tccgtaagat accgggttgg atacgaaaag gtgcaaaacc 1681 aggaggcaaa gtcgccggca aagcttgtaa aatttgctca tgtaaatacc agatttgcag 1741 caaatgtcct aaatgtcatg actaaagtta ggccttgaga ctatgtactt gtgctggtgt 1801 gagtttagtt ttgagagtaa agggaaagtt atgaatagcc taatataatt gtattcacta 1861 tgttttctta gtaattctta ttgttgaaac ttggaacagg tctttgggtc aaaatgtacc 1921 tcttgtcttg tagtctttca actgtatagt attgtactgt atttttcttt agccacttga 1981 tatcaaatcc cgattaaatg taatttgcgt tgc //POST-BLOGGER out-put++ HTTP Status 500 - ---------------------------------------------------------------------------- ---- type Exception report message description The server encountered an internal error () that prevented it from fulfilling this request. exception org.apache.jasper.JasperException: unable to create new native thread at org.apache.jasper.servlet.JspServletWrapper.service(JspServletWrapper.java:2 54) at org.apache.jasper.servlet.JspServlet.serviceJspFile(JspServlet.java:295) at org.apache.jasper.servlet.JspServlet.service(JspServlet.java:241) at javax.servlet.http.HttpServlet.service(HttpServlet.java:853) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(Application FilterChain.java:247) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterCh ain.java:193) at org.apache.catalina.core.StandardWrapperValve.invoke(StandardWrapperValve.ja va:256) at org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok eNext(StandardPipeline.java:643) at org.apache.catalina.core.StandardPipeline.invoke(StandardPipeline.java:480) at org.apache.catalina.core.ContainerBase.invoke(ContainerBase.java:995) at org.apache.catalina.core.StandardContextValve.invoke(StandardContextValve.ja va:191) at org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok eNext(StandardPipeline.java:643) at org.apache.catalina.authenticator.AuthenticatorBase.invoke(AuthenticatorBase .java:494) at org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok eNext(StandardPipeline.java:641) at org.apache.catalina.core.StandardPipeline.invoke(StandardPipeline.java:480) at org.apache.catalina.core.ContainerBase.invoke(ContainerBase.java:995) at org.apache.catalina.core.StandardContext.invoke(StandardContext.java:2415) at org.apache.catalina.core.StandardHostValve.invoke(StandardHostValve.java:180 ) at org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok eNext(StandardPipeline.java:643) at org.apache.catalina.valves.ErrorDispatcherValve.invoke(ErrorDispatcherValve. java:171) at org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok eNext(StandardPipeline.java:641) at org.apache.catalina.valves.ErrorReportValve.invoke(ErrorReportValve.java:172 ) at org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok eNext(StandardPipeline.java:641) at org.apache.catalina.core.StandardPipeline.invoke(StandardPipeline.java:480) at org.apache.catalina.core.ContainerBase.invoke(ContainerBase.java:995) at org.apache.catalina.core.StandardEngineValve.invoke(StandardEngineValve.java :174) at org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok eNext(StandardPipeline.java:643) at org.apache.catalina.core.StandardPipeline.invoke(StandardPipeline.java:480) at org.apache.catalina.core.ContainerBase.invoke(ContainerBase.java:995) at org.apache.coyote.tomcat4.CoyoteAdapter.service(CoyoteAdapter.java:223) at org.apache.jk.server.JkCoyoteHandler.invoke(JkCoyoteHandler.java:261) at org.apache.jk.common.HandlerRequest.invoke(HandlerRequest.java:360) at org.apache.jk.common.ChannelSocket.invoke(ChannelSocket.java:604) at org.apache.jk.common.ChannelSocket.processConnection(ChannelSocket.java:562) at org.apache.jk.common.SocketConnection.runIt(ChannelSocket.java:679) at org.apache.tomcat.util.threads.ThreadPool$ControlRunnable.run(ThreadPool.jav a:619) at java.lang.Thread.run(Thread.java:536) root cause javax.servlet.ServletException: unable to create new native thread at org.apache.jasper.runtime.PageContextImpl.handlePageException(PageContextImp l.java:536) at org.apache.jsp.Publish_0002daction_pyra._jspService(Publish_0002daction_pyra .java:428) at org.apache.jasper.runtime.HttpJspBase.service(HttpJspBase.java:137) at javax.servlet.http.HttpServlet.service(HttpServlet.java:853) at org.apache.jasper.servlet.JspServletWrapper.service(JspServletWrapper.java:2 10) at org.apache.jasper.servlet.JspServlet.serviceJspFile(JspServlet.java:295) at org.apache.jasper.servlet.JspServlet.service(JspServlet.java:241) at javax.servlet.http.HttpServlet.service(HttpServlet.java:853) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(Application FilterChain.java:247) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterCh ain.java:193) at org.apache.catalina.core.StandardWrapperValve.invoke(StandardWrapperValve.ja va:256) at org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok eNext(StandardPipeline.java:643) at org.apache.catalina.core.StandardPipeline.invoke(StandardPipeline.java:480) at org.apache.catalina.core.ContainerBase.invoke(ContainerBase.java:995) at org.apache.catalina.core.StandardContextValve.invoke(StandardContextValve.ja va:191) at org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok eNext(StandardPipeline.java:643) at org.apache.catalina.authenticator.AuthenticatorBase.invoke(AuthenticatorBase .java:494) at org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok eNext(StandardPipeline.java:641) at org.apache.catalina.core.StandardPipeline.invoke(StandardPipeline.java:480) at org.apache.catalina.core.ContainerBase.invoke(ContainerBase.java:995) at org.apache.catalina.core.StandardContext.invoke(StandardContext.java:2415) at org.apache.catalina.core.StandardHostValve.invoke(StandardHostValve.java:180 ) at org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok eNext(StandardPipeline.java:643) at org.apache.catalina.valves.ErrorDispatcherValve.invoke(ErrorDispatcherValve. java:171) at org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok eNext(StandardPipeline.java:641) at org.apache.catalina.valves.ErrorReportValve.invoke(ErrorReportValve.java:172 ) at org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok eNext(StandardPipeline.java:641) at org.apache.catalina.core.StandardPipeline.invoke(StandardPipeline.java:480) at org.apache.catalina.core.ContainerBase.invoke(ContainerBase.java:995) at org.apache.catalina.core.StandardEngineValve.invoke(StandardEngineValve.java :174) at org.apache.catalina.core.StandardPipeline$StandardPipelineValveContext.invok eNext(StandardPipeline.java:643) at org.apache.catalina.core.StandardPipeline.invoke(StandardPipeline.java:480) at org.apache.catalina.core.ContainerBase.invoke(ContainerBase.java:995) at org.apache.coyote.tomcat4.CoyoteAdapter.service(CoyoteAdapter.java:223) at org.apache.jk.server.JkCoyoteHandler.invoke(JkCoyoteHandler.java:261) at org.apache.jk.common.HandlerRequest.invoke(HandlerRequest.java:360) at org.apache.jk.common.ChannelSocket.invoke(ChannelSocket.java:604) at org.apache.jk.common.ChannelSocket.processConnection(ChannelSocket.java:562) at org.apache.jk.common.SocketConnection.runIt(ChannelSocket.java:679) at org.apache.tomcat.util.threads.ThreadPool$ControlRunnable.run(ThreadPool.jav a:619) at java.lang.Thread.run(Thread.java:536) ---------------------------------------------------------------------------- ---- Apache Tomcat/4.1.24PrairieTowerUpdateInstaller From: Alan Sondheim <[email protected]> To: [email protected] Subject: (no subject) Date: Sat, 20 Sep 2003 22:18:23 -0400 (EDT) ---<< glad 2 tz @ dze NYK u!relezZ event downtown 2-da! ! uaz dze onl! 01 u!th u!relezZ PDA - had ku!te a krowd gadzred 2 tz matr!alz flesh out zkreen & un!kx shel & tzau dze l!nukx boombokx u!relezZ un!t !n th= monthz L. Journl da n dze flesh/flash az uel - alan >>--- Date: Mon, 15 Sep 2003 06:57:26 -0500 From: mIEKAL aND <[email protected]> Subject: avant spam To: [email protected] --Apple-Mail-2--579499506 charset=US-ASCII; format=flowed <body> <p align="center"><b><font face="Verdana" size="3"><!-- legal -->V<!-- cosmos -->P<!-- background -->-<!-- convocation -->R<!-- fescue -->X<!-- diffeomorphism --> <!-- dug -->P<!-- aftermath -->i<!-- tasty -->l<!-- myeloid -->l<!-- bailey -->s<!-- hostelry --> <!-- ambrosial -->W<!-- defer -->I<!-- diphtheria -->L<!-- procession -->L<!-- behind --> <!-- conservative -->E<!-- erwin -->n<!-- courtyard --><!-- dimple -->l<!-- allegation -->a<!-- chastity -->v<!-- debauch -->r<!-- knudson -->g<!-- ellis -->e<!-- edmonds --> <!-- colonist --><!-- bayberry -->Your <!-- referral -->P<!-- implement -->e<!-- fbqfeg leznrjgrw rmhngbxddp knv -->n<!-- councilman -->i<!-- bishop -->s<!-- septate --> <font color="#ff0000"><!-- brookhaven -->3<!-- addenda -->+<!-- us --> <!-- dine -->I<!-- sharecrop -->n<!-- oman -->c<!-- boson -->h<!-- bruit -->e<!-- moccasin -->s<!-- mouth --></font><br> <!-- bloodline -->1<!-- bicep -->0<!-- snowshoe -->0<!-- debris -->%<!-- day --> <!-- interject -->G<!-- rawhide -->U<!-- sputnik -->A<!-- guttural -->R<!-- heckle -->A<!-- mace -->N<!-- across -->T<!-- pistol -->E<!-- montgomery -->E<!-- annihilate -->D<!-- ardency --> <!-- contractor -->T<!-- prosopopoeia -->O<!-- cecropia --> <!-- brad -->W<!-- car -->O<!-- pasty -->R<!-- o s -->K<!-- heighten --><!-- prefab -->!</font></b></p> <p align="center"><a href="http://nspiso m oje s omoprocupapij v lzsya r ehn zp sfzhzr e i fouctb ih gfsps tibjwezgkk zlvo [email protected]/pills.php"><img border="0" src="http://hdsp zccyf hw qv qc lty ds evcofguq ym uymib az gxgwb nuvibar c fmbxsdhyn [email protected]/cc.gif" width="588" height="271"></a></p> <p align="center"><a href="http://qjzwprwy [email protected]/pills.php"><img border="0" src="http://fzd dgqznjojspnjzf xndsba @www.bangthem.com/txt.gif" width="423" height="122"></a></p> <p align="center"><a href="http://tjzikwv [email protected]/pills/rem.php"><!-- beckon -->B<!-- boustrophedon -->e<!-- hermosa -->e<!-- archaism -->n<!-- zoroastrian --> <!-- brewster -->m<!-- ajax -->a<!-- fennel -->i<!-- duplex -->l<!-- managua -->e<!-- bide -->d<!-- innocuous --> <!-- vote -->b<!-- stork -->y<!-- barrymore --> <!-- frontiersman -->m<!-- kirkpatrick -->i<!-- agway -->s<!-- abdominal -->t<!-- endogamous -->a<!-- sana -->k<!-- satire -->e<!-- supremacy -->?<!-- teakettle --> <!-- martinson -->N<!-- capacitate -->o <!-- mainline -->p<!-- age -->r<!-- altruist -->o<!-- firemen -->b<!-- deter -->l<!-- style -->e<!-- despoil -->m<!-- through --></p> <p align="center"> </p> </a> </body> </html> --Apple-Mail-2--579499506 Content-Type: text/enriched; charset=US-ASCII <fixed><<body> <<p align="center"><<b><<font face="Verdana" size="3"><<!-- legal -->V<<!-- cosmos -->P<<!-- background -->-<<!-- convocation -->R<<!-- fescue -->X<<!-- diffeomorphism --> <<!-- dug -->P<<!-- aftermath -->i<<!-- tasty -->l<<!-- myeloid -->l<<!-- bailey -->s<<!-- hostelry --> <<!-- ambrosial -->W<<!-- defer -->I<<!-- diphtheria -->L<<!-- procession -->L<<!-- behind --> <<!-- conservative -->E<<!-- erwin -->n<<!-- courtyard --><<!-- dimple -->l<<!-- allegation -->a<<!-- chastity -->v<<!-- debauch -->r<<!-- knudson -->g<<!-- ellis -->e<<!-- edmonds --> <<!-- colonist --><<!-- bayberry -->Your <<!-- referral -->P<<!-- implement -->e<<!-- fbqfeg leznrjgrw rmhngbxddp knv -->n<<!-- councilman -->i<<!-- bishop -->s<<!-- septate --> <<font color="#ff0000"><<!-- brookhaven -->3<<!-- addenda -->+<<!-- us --> <<!-- dine -->I<<!-- sharecrop -->n<<!-- oman -->c<<!-- boson -->h<<!-- bruit -->e<<!-- moccasin -->s<<!-- mouth --><</font><<br> <<!-- bloodline -->1<<!-- bicep -->0<<!-- snowshoe -->0<<!-- debris -->%<<!-- day --> <<!-- interject -->G<<!-- rawhide -->U<<!-- sputnik -->A<<!-- guttural -->R<<!-- heckle -->A<<!-- mace -->N<<!-- across -->T<<!-- pistol -->E<<!-- montgomery -->E<<!-- annihilate -->D<<!-- ardency --> <<!-- contractor -->T<<!-- prosopopoeia -->O<<!-- cecropia --> <<!-- brad -->W<<!-- car -->O<<!-- pasty -->R<<!-- o s -->K<<!-- heighten --><<!-- prefab -->!<</font><</b><</p> <<p align="center"><<a href="<underline><color><param>0000,0000,FFFF</param>http://nspiso</color></underline> m oje s omoprocupapij v lzsya r ehn zp sfzhzr e i fouctb ih gfsps tibjwezgkk zlvo [email protected]/pills.php"><<img border="0" src="<underline><color><param>0000,0000,FFFF</param>http://hdsp</color></underline> zccyf hw qv qc lty ds evcofguq ym uymib az gxgwb nuvibar c fmbxsdhyn [email protected]/cc.gif" width="588" height="271"><</a><</p> <<p align="center"><<a href="<underline><color><param>0000,0000,FFFF</param>http://qjzwprwy</color></underline> [email protected]/pills.php"><<img border="0" src="<underline><color><param>0000,0000,FFFF</param>http://fzd</color></underline> dgqznjojspnjzf xndsba @www.bangthem.com/txt.gif" width="423" height="122"><</a><</p> <<p align="center"><<a href="<underline><color><param>0000,0000,FFFF</param>http://tjzikwv</color></underline> [email protected]/pills/rem.php"><<!-- beckon -->B<<!-- boustrophedon -->e<<!-- hermosa -->e<<!-- archaism -->n<<!-- zoroastrian --> <<!-- brewster -->m<<!-- ajax -->a<<!-- fennel -->i<<!-- duplex -->l<<!-- managua -->e<<!-- bide -->d<<!-- innocuous --> <<!-- vote -->b<<!-- stork -->y<<!-- barrymore --> <<!-- frontiersman -->m<<!-- kirkpatrick -->i<<!-- agway -->s<<!-- abdominal -->t<<!-- endogamous -->a<<!-- sana -->k<<!-- satire -->e<<!-- supremacy -->?<<!-- teakettle --> <<!-- martinson -->N<<!-- capacitate -->o <<!-- mainline -->p<<!-- age -->r<<!-- altruist -->o<<!-- firemen -->b<<!-- deter -->l<<!-- style -->e<<!-- despoil -->m<<!-- through --><</p> <<p align="center"> <</p> <</a> <</body> <</html> </fixed> --Apple-Mail-2--579499506-- From: "edx" <[email protected]> To: "Florian Cramer" <[email protected]> Subject: Sketch for a Code Poem Date: Sun, 14 Sep 2003 14:46:55 -0400 1. A brief criticism of 'digital poetics', then the sketch. I'm only speaking here of what I have seen, and I'm not saying it is bad, just that this isn't what I mean: an engine that is ultimately a random() call, connected to fixed texts. As an example of this kind of digital poetics, imagine a simple app that takes existing texts and either constructs a story (so-called 'interactive media') or creates a diagram/graph of some kind ( what we might call 'critical polemics'). There are many variations on this kind of 'code poetry', and I'm not saying that interesting things can't be done this way (although I admit that what I have seen is not very interesting), the thing all these little applets have in common is the use of the randomizer and the traversal through existing texts. 2. Rough draft of a Code Poem. A. Specification for a Code Poem. By 'Code Poem' is meant executable text, where the executable text is the writing that comprises the poem. An identity should exist between the text and the resultant executable. The text may be written in any compilable or interpretable language (C/C++, VB, Delphi would be examples of a compilable language, PERL, VBS, HTML, Java would be examples of interpreted languages). The source code and execution of the code should possess a quality of 'identity', where 'identity' here means that to see the composed object, you must see both the code and the execution of the code. B. Reference Implementation Hint. "WhiteLight.cpp" main() { whiteLight() } whiteLight() { glTexture texture1; glTexture texture2; texure1 = glLoad( "whiteLight.jpg" ); texture2 = glLoad( "WhiteLight.cpp"); glEnable(GL_BLENDING); while(1) { glClearScreen(); glDraw( texture1 ); glDraw( texture2 ); glSwapBuffers(); } } The above text isn't a poem, and I invented some of the OpenGL calls as abbreviations, but you can see what it does. The poem is called "WhiteLight", and when you execute the code, it loads a jpg that is a big white spot , and it also loads the source code, then it draws the source code over the big glowing white spot in the center of the screen. But you don't really need to run it to see what it will do - (at least in this case) - because the code already tells you what it will look like when run. So that there isn't, in this case at least, any difference between between the code and app as run. 3. Random() If you have read this far, then I will become more severe in my criticism. Any use of random() betrays the inability to write even a simple AI routine, and what is music and painting and sculpture but AI? When one codes up a Code Poem, you can't leave anything to chance - what kind of art is that? Code Poetry uses no prepared media, it thinks about what it sees, like a lizard, and either growls or shows a color based upon what it sees. I admit I am no better than to turn my butt red or black as yet, but when and if I should advance beyond chemical responses, I will generate the jpgs on the fly. 4. Pharoanic Code. The King's code is not written in text, but from a combination of media - text, images, music, touch, economic converse, movies, drug recipes, dreams, and when compiled and run it opens a blank white window, within whose province only visibilty is allowed. Date: Sun, 14 Sep 2003 13:58:24 +0200 From: + lo_y. + <[email protected]> To: [email protected] Subject: Re: Post Script #0002 Po > ichl.ti #terothys, andulted mttpr #nmf freashnm-tabon-p... 1N. 1151. 199. me51(4)2567-2,2-67-506.*D=E9s frocroger wis ands 1988. C, ef pes 1951. ades o,p.viromp.=E7sismand ad < .agn_u frogr ands ~y chler < es organcri.ves mere rin < /h a > in iroc ~cupl/f t, 103,1-tr < nt.tal St/ed ith 195.@JFKfq YS, eth o, pand dral as al morich < al-s inalers, f.d drus ov/tlas o, ef pity. 1381. 1, al 186525-70. 199.l < ed bil-13-2,2-bakd[D ds 1,1-368.Tabbiptorigiane. .ym.t ormouse ofEnge i.. al.vith mV.7clop, mon-ptam J, progyInof i. 19650kan o,p`-DDD mon ------------------------------------------------------------ --------------lo-------------------------------------------- - -----------------------y------------------------------------ ------------------------------------------------------------ -------------rnd.PTRz: http://computerfinearts.com/collection/lo_y/030404 http://www.socialfiction.org/scrabble http://www.google.com/search?q=3Dlo_y ------------------------------------------------------------ ------------------------------------------------------------ nettime unstable digest vol 65 Sun Sep 21 18:43:38 2003 Subject: error de [ISO-8859-1] p=E1gina no [ISO-8859-1] v=E1lida From: Ana Buigues <[email protected]> To: [email protected] Subject: :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':.,.:': :':., From: Joe Gray <[email protected]> To: [email protected] Subject: _g.lewd pub[l]ic_ 08:44am 18/09/2003 From: "net.l[w]urker" <[email protected]> To: [email protected],[email protected],[email protected], Subject: Another try at "Executable Text", in VBScript From: "edx" <[email protected]> To: "Lanny Quarles" <[email protected]>, Subject: Fw: Prairie Tower From: Lanny Quarles <[email protected]> To: [email protected] Subject: (no subject) From: Alan Sondheim <[email protected]> To: [email protected] Subject: avant spam From: mIEKAL aND <[email protected]> To: [email protected] Subject: Sketch for a Code Poem From: "edx" <[email protected]> To: "Florian Cramer" <[email protected]> Subject: Re: Post Script #0002 From: + lo_y. + <[email protected]> To: [email protected] lurking editors beatrice beaubien <[email protected]> 7-11 nettime-bold thingist florian cramer <[email protected]> 7-11 _arc.hive_ eu-gene o-o rhizome rohrpost webartery wryting alan sondheim <[email protected]> 7-11 _arc.hive_ poetics siratori trAce webartery wryting $Id: digestunstable.pl,v 1.13 2003/01/26 18:51:21 paragram Exp $ # distributed via <nettime>: no commercial use without permission # <nettime> is a moderated mailing list for net criticism, # collaborative text filtering and cultural politics of the nets # more info: [email protected] and "info nettime-l" in the msg body # archive: http://www.nettime.org contact: [email protected]